Disclaimer: ClinPep is for educational and research reference purposes only. This platform does not provide medical advice, diagnosis, or treatment recommendations.

Immune — Antimicrobial Peptide✓ FDA Approved

LL-37

Also known as: Cathelicidin · Human cathelicidin antimicrobial peptide · hCAP18

MW

4493.37 Da

Amino Acids

37 AA

Half-Life

4 hours

Route

SubQ, Topical

Formula

C205H340N60O53

Amino Acid Sequence

[LL-37, 37 aa]

Mechanism of Action

LL-37 is the sole human cathelicidin — a 37-amino acid antimicrobial peptide naturally produced by neutrophils, epithelial cells, macrophages, and keratinocytes in response to infection and tissue injury.

DIRECT ANTIMICROBIAL: LL-37's amphipathic α-helical structure inserts into bacterial cell membranes, forming pores that cause rapid cell lysis. Effective against gram-positive and gram-negative bacteria, fungi, and enveloped viruses. Kills pathogens within minutes — faster than adaptive immunity.

ENDOTOXIN NEUTRALIZATION: Binds lipopolysaccharide (LPS) with high affinity, neutralizing bacterial endotoxin and preventing septic cascade activation.

IMMUNE CELL RECRUITMENT: Chemotactic — recruits neutrophils, monocytes, and T-cells to infection sites via FPR2 (formyl peptide receptor 2).

WOUND HEALING: Promotes keratinocyte migration and proliferation via EGFR transactivation. Stimulates angiogenesis at wound sites.

ADAPTIVE IMMUNITY: Activates dendritic cells → enhanced antigen presentation → bridges innate and adaptive immunity.

Vitamin D directly upregulates LL-37 expression — this is a key mechanism by which vitamin D supports immune function.

Dosing Protocol

Low Dose

███ – ███ mcg/day

Standard Dose

███ mcg/day

High Dose

███ – ███ mcg/day

Dosing protocols are for paid members

Get exact dosing ranges, injection frequency, timing rationale, and reconstitution math.

Get Clinical Access — $79/mo

Frequency

Daily or every other day during infection/immune challenge.

Half-Life

4 hours

Reconstitution Guide

Full reconstitution protocol with BAC water volumes, concentration math, and units-to-draw per dose is available on the Clinical plan.

Unlock reconstitution guide →

Clinical Warnings

Pro-inflammatory at high doses (excessive neutrophil activation).

Potential autoimmune exacerbation.

Antimicrobial resistance theoretical concern.

Not FDA approved for therapeutic use.

Quality from compounding variable.

Contraindications

Absolute

Pregnancy

Relative Cautions

Autoimmune disease

Psoriasis (may worsen)

Rosacea

Side Effect Profile

Mild

  • Injection site reaction
  • Mild redness

Moderate

  • Localized inflammation
  • Headache

Severe (Rare)

  • Autoimmune flare
  • Excessive inflammation

Synergistic Peptides

Thymosin Alpha-1KPVBPC-157

Common Stacks

Thymosin Alpha-1

KPV

BPC-157

Research Status

Well-characterized biochemistry. PMID 11278193 (Agerberth 1995): Human cathelicidin characterization. PMID 22474249 (Heilborn 2003): Wound healing promotion. Extensive mechanistic data, limited therapeutic human RCTs.

Frequently Asked Questions

How does LL-37 work?

LL-37 is the sole human cathelicidin — a 37-amino acid antimicrobial peptide naturally produced by neutrophils, epithelial cells, macrophages, and keratinocytes in response to infection and tissue injury. DIRECT ANTIMICROBIAL: LL-37's amphipathic α-helical structure inserts into bacterial cell membranes, forming pores that cause rapid cell lysis. Effective against gram-positive and gram-negative bacteria, fungi, and enveloped viruses. Kills pathogens within minutes — faster than adaptive immuni

What is the standard dose of LL-37?

LL-37 dosing protocols are available with a ClinPep Clinical subscription. Dosing varies by indication and patient factors — consult a licensed healthcare provider. General frequency: Daily or every other day during infection/immune challenge.

What is the half-life of LL-37?

The half-life of LL-37 is 4 hours. This determines optimal dosing frequency and timing.

Who should not use LL-37?

LL-37 is absolutely contraindicated in: Pregnancy. Use with caution in: Autoimmune disease; Psoriasis (may worsen); Rosacea.

What are the side effects of LL-37?

Common mild side effects include: Injection site reaction, Mild redness. Moderate effects: Localized inflammation, Headache.

What peptides stack well with LL-37?

LL-37 is commonly stacked with: Thymosin Alpha-1, KPV, BPC-157.

How do you reconstitute LL-37?

LL-37 is reconstituted with bacteriostatic water. Exact volumes, concentrations, and units-to-draw calculations are available in the ClinPep Clinical plan. Always follow your compounding pharmacy's instructions.

How long should you cycle LL-37?

LL-37 cycle protocols vary by indication. Detailed cycle length, on/off schedules, and monitoring guidelines are available with ClinPep Clinical access. Consult your healthcare provider for personalized cycling guidance.

References & Citations

10 PubMed studies · 3 clinical trials

The dysregulation of innate immunity by Porphyromonas gingivalis in the etiology of Alzheimer's disease.

Barron Annelise E, Lin Jennifer S, Ryder Mark I, Bergman Peter. Journal of internal medicine. 2026

PubMed: 41424314DOI ↗C — Research Article

The etiology of Alzheimer's disease (AD) remains under active debate. In this perspective, we explore the hypothesis that a primarily infection-caused chronic dysregulation and weakening of human inna

Functional characterization of Cr-CATHs: Novel antimicrobial peptides from the coastal bird Chroicocephalus ridibundus.

Dou Haoran, Li Shuangyu, Zhang Pingchuan, Ye Zifan et al.. Biochimie. 2026

PubMed: 41421641DOI ↗C — Research Article

The escalating global threat of antimicrobial resistance (AMR) and chronic biofilm-associated infections underscores the urgent need for novel therapeutic agents. Antimicrobial peptides (AMPs) offer a

LL37-induced mitochondrial stress activates the mtDNA/cGAS/STING pathway to promote mast cell-mediated rosacea inflammation.

Sun Rui, Fan Huiping, Ma Qingsong, Li Xiaojin et al.. Free radical biology & medicine. 2026

PubMed: 41421415DOI ↗C — Research Article

Rosacea is a chronic inflammatory skin disease characterized by persistent facial erythema and telangiectasia. The antimicrobial peptide LL37 is a key initiator in rosacea, with mast cells serving as

Pneumococcal S protein coordinates cell wall modification and repair to resist host antimicrobials.

Burnier Jessica, Gallay Clement, Bruce Kevin E, Bjånes Elisabet et al.. Nature microbiology. 2026

PubMed: 41420059DOI ↗A — High-Impact Journal

S protein is conserved among streptococci and contributes to group A Streptococcus virulence, but the mechanisms involved are unclear. Here we used genetic, biochemical, single-molecule, in vitro and

Synthetic antimicrobial peptide LD4-PP protects the host against E. coli-induced cell death.

Mohanty Soumitra, White John Kerr, Yin Yundi, Muhammad Taj et al.. Frontiers in immunology. 2025

PubMed: 41415272DOI ↗C — Research Article

With antibiotic resistance being a major global concern, there is a huge need of new treatment options to fight bacterial infections. In this study, we highlight the antibacterial and host-protective

Immunomodulatory effects of QsCATH on macrophages: transcriptomic insights and molecular docking analysis.

Qiao Fen, Qian Xin-Yi, Wu Jia-Le, Wang Zi-Xuan et al.. Scientific reports. 2025

PubMed: 41387500DOI ↗C — Research Article

The molecular mechanisms underlying the immunomodulatory effects of cathelicidins on macrophages remain poorly characterized. This study aimed to elucidate the immunomodulatory mechanisms of QsCATH, a

Novel integrated approach modeling proanthocyanidins and bacteriophages to combat multidrug Salmonella Typhimurium in challenged broilers.

Al-Khalaifah Hanan S, Ibrahim Doaa, Abdelfattah-Hassan Ahmed, Ibrahim Dina et al.. Frontiers in veterinary science. 2025

PubMed: 41383965DOI ↗C — Research Article

The emergence of multidrug bacterial isolates, including Salmonella (S.) Typhimurium, which primarily spreads to humans through chicken products, is correlated with a rising prevalence of antimicrobia

Host defense peptides in malaria infection: their contributions, significance and constraints.

Alfaki Dia Aldeen, Elbasheir Mohamed Mubarak. Malaria journal. 2025

PubMed: 41351171DOI ↗C — Research Article

Plasmodium-induced malaria infection remains a leading global health threat. Host defense peptides (HDPs), key components of innate immunity, target multiple stages of Plasmodium development through d

Registered Clinical Trials

Cellular Immunotherapy for Septic Shock

NCT03369275UNKNOWNPHASE2

The Effects of Vitamin D Supplementation on Aerobic Fitness in Athletes

NCT02278172COMPLETEDPHASE4

The Role of Anti-inflammatory Cytokines and Antimicrobial Peptide LL-37 Biomarkers in the Treatment of Periodontal Disease.

Symptom Indications

Chronic infectionsWound infectionsBiofilm infectionsImmune weaknessSlow wound healing

Full Clinical Access

Complete LL-37 Protocol

Access reconstitution math, cycle guides, drug interaction checker, stack builder with contraindication analysis, symptom checker, and downloadable PDF handouts.

Secure payment powered by Stripe.

This information is for educational and research reference purposes only. ClinPep does not provide medical advice, diagnosis, or treatment recommendations. All protocols should be reviewed by a licensed healthcare provider.