CJC-1295 with DAC
Also known as: CJC-1295 DAC · Drug Affinity Complex CJC-1295
Contents
MW
3647.28 Da
Amino Acids
30 AA
Half-Life
8 days
Route
SubQ
CAS
863288-34-0
Formula
C152H252N44O42S
Amino Acid Sequence
YADAIFTQSYRKVLAQLSARKLLQDILSR-DAC
Mechanism of Action
CJC-1295 with DAC (Drug Affinity Complex) is the same GHRH analog as CJC-1295 no-DAC but with a DAC moiety (a reactive amine that covalently binds to albumin after injection). This albumin binding extends the half-life from ~30 minutes to 6–8 days.
GHRH RECEPTOR MECHANISM: Identical to CJC-1295 no-DAC — binds GHRHR on pituitary somatotrophs → cAMP/PKA → GH release.
CONTINUOUS vs PULSATILE GH: The 6–8 day half-life means continuous GHRH receptor stimulation, producing sustained GH elevation rather than discrete pulses. Ionescu & Frohman 2006 showed that GH pulsatility IS preserved even with continuous DAC stimulation — but trough GH levels are significantly elevated (7.5-fold increase), creating a "GH bleed" effect.
CONVENIENCE vs PHYSIOLOGY: Once-weekly injection (vs nightly for no-DAC). However, the continuously elevated trough GH is less physiologic and may produce more GH-related side effects (water retention, carpal tunnel, joint pain, insulin resistance).
Most practitioners prefer no-DAC for physiologic pulsatility, reserving DAC for patients who cannot comply with nightly injection protocols.
Dosing Protocol
Low Dose
███ – ███ mcg/day
Standard Dose
███ mcg/day
High Dose
███ – ███ mcg/day
Dosing protocols are for paid members
Get exact dosing ranges, injection frequency, timing rationale, and reconstitution math.
Get Clinical Access — $79/moFrequency
Once weekly SubQ.
Half-Life
8 days
Reconstitution Guide
Full reconstitution protocol with BAC water volumes, concentration math, and units-to-draw per dose is available on the Clinical plan.
Unlock reconstitution guide →Clinical Warnings
Continuous GH elevation ('GH bleed') less physiologic than pulsatile.
Higher risk of GH side effects (water retention, carpal tunnel, insulin resistance) vs no-DAC.
Receptor desensitization risk with sustained stimulation.
Same warnings as CJC-1295 no-DAC apply.
WADA prohibited.
Contraindications
Absolute
Active cancer
Pregnancy
Active pituitary tumor
Relative Cautions
Diabetes
History of cancer
Water retention disorders
Side Effect Profile
Mild
- ●Water retention
- ●Injection site reaction
- ●Mild tingling
Moderate
- ●Persistent GH bleed (non-pulsatile)
- ●Joint swelling
- ●Headache
Severe (Rare)
- ●Potential tumor growth
- ●Prolonged water retention
Synergistic Peptides
Common Stacks
Ipamorelin
GHRP-2
Research Status
MODERATE (same trials as CJC-1295). Teichman 2006 (PMID 16352683): GH 2–10x for 6+ days, IGF-1 1.5–3x for 9–11 days. Ionescu 2006 (PMID 16682504): Pulsatility preserved but trough GH significantly elevated. Clinically, no-DAC generally preferred.
Frequently Asked Questions
How does CJC-1295 with DAC work?
CJC-1295 with DAC (Drug Affinity Complex) is the same GHRH analog as CJC-1295 no-DAC but with a DAC moiety (a reactive amine that covalently binds to albumin after injection). This albumin binding extends the half-life from ~30 minutes to 6–8 days. GHRH RECEPTOR MECHANISM: Identical to CJC-1295 no-DAC — binds GHRHR on pituitary somatotrophs → cAMP/PKA → GH release. CONTINUOUS vs PULSATILE GH: The 6–8 day half-life means continuous GHRH receptor stimulation, producing sustained GH elevation rat
What is the standard dose of CJC-1295 with DAC?
CJC-1295 with DAC dosing protocols are available with a ClinPep Clinical subscription. Dosing varies by indication and patient factors — consult a licensed healthcare provider. General frequency: Once weekly SubQ.
What is the half-life of CJC-1295 with DAC?
The half-life of CJC-1295 with DAC is 8 days. This determines optimal dosing frequency and timing.
Who should not use CJC-1295 with DAC?
CJC-1295 with DAC is absolutely contraindicated in: Active cancer; Pregnancy; Active pituitary tumor. Use with caution in: Diabetes; History of cancer; Water retention disorders.
What are the side effects of CJC-1295 with DAC?
Common mild side effects include: Water retention, Injection site reaction, Mild tingling. Moderate effects: Persistent GH bleed (non-pulsatile), Joint swelling, Headache.
What peptides stack well with CJC-1295 with DAC?
CJC-1295 with DAC is commonly stacked with: Ipamorelin, GHRP-2, Sermorelin.
How do you reconstitute CJC-1295 with DAC?
CJC-1295 with DAC is reconstituted with bacteriostatic water. Exact volumes, concentrations, and units-to-draw calculations are available in the ClinPep Clinical plan. Always follow your compounding pharmacy's instructions.
How long should you cycle CJC-1295 with DAC?
CJC-1295 with DAC cycle protocols vary by indication. Detailed cycle length, on/off schedules, and monitoring guidelines are available with ClinPep Clinical access. Consult your healthcare provider for personalized cycling guidance.
References & Citations
2 PubMed studies · 0 clinical trials
Prolonged stimulation of GH and IGF-I by CJC-1295 in healthy adults
Teichman SL et al.. J Clin Endocrinol Metab. 2006
Pulsatile GH secretion persists during continuous CJC-1295 stimulation
Ionescu M, Frohman LA. J Clin Endocrinol Metab. 2006
Symptom Indications
Full Clinical Access
Complete CJC-1295 with DAC Protocol
Access reconstitution math, cycle guides, drug interaction checker, stack builder with contraindication analysis, symptom checker, and downloadable PDF handouts.
Secure payment powered by Stripe.
This information is for educational and research reference purposes only. ClinPep does not provide medical advice, diagnosis, or treatment recommendations. All protocols should be reviewed by a licensed healthcare provider.