VIP
Also known as: Vasoactive Intestinal Peptide · Aviptadil
Contents
MW
3326.82 Da
Amino Acids
28 AA
Half-Life
2 minutes (rapid)
Route
Intranasal, SubQ, IV
CAS
37221-79-7
Formula
C147H237N43O43S
Amino Acid Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Mechanism of Action
VIP (Vasoactive Intestinal Peptide) is a 28-amino acid neuropeptide that binds VPAC1 and VPAC2 receptors (Gs-coupled → adenylyl cyclase → cAMP). It is one of the most potent endogenous vasodilators.
VASODILATION: Potent relaxation of vascular and bronchial smooth muscle. Pulmonary vasodilation is the basis for aviptadil (synthetic VIP) use in pulmonary hypertension and ARDS.
ANTI-INFLAMMATORY: Potent immune regulation — inhibits Th1 responses, reduces TNF-α, IL-6, IL-12 production by macrophages and dendritic cells. Promotes Th2/Treg shift. This makes VIP relevant for autoimmune conditions and chronic inflammatory response syndrome (CIRS).
GI FUNCTION: Stimulates water and electrolyte secretion, relaxes GI smooth muscle, promotes intestinal motility. VIP-secreting tumors (VIPomas) cause profuse watery diarrhea.
NEUROPROTECTION: VIP is a neuropeptide with CNS distribution. Promotes neuronal survival and synaptic function.
CIRCADIAN: Regulates circadian rhythm in the suprachiasmatic nucleus.
Dosing Protocol
Low Dose
███ – ███ mcg/day
Standard Dose
███ mcg/day
High Dose
███ – ███ mcg/day
Dosing protocols are for paid members
Get exact dosing ranges, injection frequency, timing rationale, and reconstitution math.
Get Clinical Access — $79/moFrequency
Daily SubQ or intranasal.
Half-Life
2 minutes (rapid)
Reconstitution Guide
Full reconstitution protocol with BAC water volumes, concentration math, and units-to-draw per dose is available on the Clinical plan.
Unlock reconstitution guide →Clinical Warnings
Vasodilation → hypotension risk, especially with antihypertensives.
GI effects (diarrhea, cramping).
Short half-life (~2 min IV).
IV requires clinical setting.
Tachycardia possible.
Not FDA approved for most indications.
Contraindications
Absolute
Pregnancy
Relative Cautions
Hypotension
Diarrheal conditions
Side Effect Profile
Mild
- ●Nasal congestion
- ●Mild diarrhea
- ●Flushing
Moderate
- ●Hypotension
- ●Tachycardia
- ●Headache
Severe (Rare)
- ●Severe hypotension
Synergistic Peptides
Common Stacks
KPV
BPC-157
Research Status
MODERATE. PMID 19416873 (Abad 2010): Anti-inflammatory mechanisms in autoimmune disease. PMID 15148335 (Hamidi 2004): Aviptadil pulmonary hypertension Phase II. COVID-19 ARDS data. Well-characterized biochemistry.
Frequently Asked Questions
How does VIP work?
VIP (Vasoactive Intestinal Peptide) is a 28-amino acid neuropeptide that binds VPAC1 and VPAC2 receptors (Gs-coupled → adenylyl cyclase → cAMP). It is one of the most potent endogenous vasodilators. VASODILATION: Potent relaxation of vascular and bronchial smooth muscle. Pulmonary vasodilation is the basis for aviptadil (synthetic VIP) use in pulmonary hypertension and ARDS. ANTI-INFLAMMATORY: Potent immune regulation — inhibits Th1 responses, reduces TNF-α, IL-6, IL-12 production by macrophag
What is the standard dose of VIP?
VIP dosing protocols are available with a ClinPep Clinical subscription. Dosing varies by indication and patient factors — consult a licensed healthcare provider. General frequency: Daily SubQ or intranasal.
What is the half-life of VIP?
The half-life of VIP is 2 minutes (rapid). This determines optimal dosing frequency and timing.
Who should not use VIP?
VIP is absolutely contraindicated in: Pregnancy. Use with caution in: Hypotension; Diarrheal conditions.
What are the side effects of VIP?
Common mild side effects include: Nasal congestion, Mild diarrhea, Flushing. Moderate effects: Hypotension, Tachycardia, Headache.
What peptides stack well with VIP?
VIP is commonly stacked with: KPV, BPC-157, LL-37.
How do you reconstitute VIP?
VIP is reconstituted with bacteriostatic water. Exact volumes, concentrations, and units-to-draw calculations are available in the ClinPep Clinical plan. Always follow your compounding pharmacy's instructions.
How long should you cycle VIP?
VIP cycle protocols vary by indication. Detailed cycle length, on/off schedules, and monitoring guidelines are available with ClinPep Clinical access. Consult your healthcare provider for personalized cycling guidance.
References & Citations
10 PubMed studies · 3 clinical trials
Aviptadil Therapy in Acute Respiratory Distress Syndrome Patients: A Systematic Review and Meta-analysis.
Udupa Ashritha A, Todur Pratibha, Chaudhuri Souvik, Gupta Nitin et al.. Indian journal of critical care medicine : peer-reviewed, official publication of Indian Society of Critical Care Medicine. 2025
Acute respiratory distress syndrome (ARDS) is a life-threatening condition with a high mortality rate despite advances in supportive care. Aviptadil, a synthetic analogue of vasoactive intestinal pept
Octreotide ameliorates Bisphenol A-induced testicular toxicity via autophagy-inflammation pathway modulation.
Morad Basma B, Salem Ola M, El-Esawy Rasha Osama, Abd Elmonem Fleur F. Human & experimental toxicology. 2025
IntroductionTesticular toxicity commonly manifests as impaired spermatogenesis and testicular atrophy. Bisphenol A (BPA), a commonly used organic plasticizer, negatively affects sperm parameters, horm
Study on the neuroimmune regulatory mechanism of electroacupuncture at Zusanli acupoint for postoperative intestinal paralysis after gastrointestinal surgery.
Xu Jing-Yan, Li Cheng. World journal of gastrointestinal surgery. 2025
Postoperative intestinal paralysis is common in gastrointestinal surgery, and the study of electroacupuncture mechanisms is of great significance. To explore the neuroimmune regulatory mechanism of el
Amygdalin regulated vasoactive intestinal peptide receptor to protect alveolar epithelial barrier against lung injury induced by influenza a virus.
Song Xueyue, Wang Ting, Ye Miao, Shi Xunlong et al.. Chinese medicine. 2025
Bitter apricot kernel is a common traditional Chinese medicine used for lung diseases. Previous studies showed that Xuanbai-Chengqi decoction (XCD) containing bitter apricot kernel protected the alveo
Overexpression of colonic VIP ameliorates cognitive function and barrier system damage caused by sevoflurane anesthesia and surgery in aged rats with fragile brain functions.
Liao Huihui, Wang Xinyi, Yang Chenyi, Wang Zixuan et al.. Experimental neurology. 2025
Surgery and anesthesia may compromise fragile brain function in the elderly, potentially precipitating cognitive decline or Alzheimer's disease (AD) following perioperative neurocognitive disorder (PN
Vasoactive Intestinal Peptide: A Neuropeptide that Plays an Important Role in Parkinson's Disease.
Fan Wenhui, Li Ke, Wang Ruohua, Chen Rongsha et al.. Current neuropharmacology. 2025
Parkinson's disease (PD) is primarily characterized by rigidity and tremor, which are pathologically associated with α -synuclein aggregation, especially in dopaminergic neurons in the midbrain.
Clinical Efficacy of Transcutaneous Electrical Nerve Stimulation (TENS) in Pediatric Functional Constipation: Impact on Immunological Indicators and Gut Microbiota.
Guo Piao, Zhang Xue Ning, Jin Xin Yu, Xia Wen Juan et al.. Journal of immunology research. 2025
Objective: This study was conducted to evaluate the effectiveness of transcutaneous electrical nerve stimulation (TENS) in treating pediatric functional constipation (FC) and to explore its mechanisms
A Randomized Comparison of Bencycloquidium Bromide, Mometasone Furoate, and a Combination for Persistent Allergic Rhinitis.
Li Xian, Wang Xueyan, Yang Qintai, Chen Jianjun et al.. The journal of allergy and clinical immunology. In practice. 2025
Moderate to severe persistent allergic rhinitis (AR) poses a substantial socioeconomic burden. We aimed to establish the superiority of bencycloquidium bromide (BCQB) nasal spray and BCQB combined wit
Registered Clinical Trials
Duvelisib Ameliorates Manifestations of Pneumonia in Established Novel Coronavirus Infection (COVID-19)
Efficacy and Safety of Stapokibart in Non-Allergic Rhinitis With Eosinophilia Syndrome
The Effects of a Long-lasting Infusion of Vasoactive Intestinal Peptide (VIP) on Headache, Cranial Hemodynamic and Autonomic Symptoms in Healthy Volunteers
Symptom Indications
Full Clinical Access
Complete VIP Protocol
Access reconstitution math, cycle guides, drug interaction checker, stack builder with contraindication analysis, symptom checker, and downloadable PDF handouts.
Secure payment powered by Stripe.
This information is for educational and research reference purposes only. ClinPep does not provide medical advice, diagnosis, or treatment recommendations. All protocols should be reviewed by a licensed healthcare provider.